(data stored in ACNUC7421 zone)

EMBL: AP010803.PE612

AP010803.PE612       Location/Qualifiers
FT   CDS             627443..628906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06120"
FT                   /product="hypothetical protein"
FT                   /note="putative GTPase or GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95446"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL4"
FT                   /protein_id="BAI95446.1"
FT                   /translation="MNLTLHGRLRQKLRCCPDGGGIGRKRRPSRKAGRTRQSGASVLNF
FT                   QNLAGCVFLFLVPVLCSLHCSQGDGVEKQTIGAWVVHHGRKVAADMRGAAEFSAIDLAA
FT                   KSAGLLARLGESDEATLTSDQVIAAAKVGNLNPKTELTACLDHLQKRKLIDRSASGDVS
FT                   VLGVSGSSALTHAADLFEDNDPHPTERAAITLAELASQAPVTANGAIEFLGDTHKLAKA
FT                   DATDFVLQASQIGFVDAEGEGADKLLFNGNLFRRDTASKAKKVIDSLSSAEQAKIVEFD
FT                   AKLKLRGAVTAATAIKILGEPLFAKVRAAALYDMNIVSNEAGDHVFITSPGSFHKFSNP
FT                   LTEDAFDHAKALVAALTYGMTHSPSARGQIWGIDLLLGKLIRGGSVGPATAIGNDYRAL
FT                   ELERVVQTERSGYGFKMRLLKREVGVIALEVLKGRNAAAAALETLPSAGMRSYTPPEAA
FT                   RVGLRKGQSAASRAQTRSLLSAVRGGGSL"
     MNLTLHGRLR QKLRCCPDGG GIGRKRRPSR KAGRTRQSGA SVLNFQNLAG CVFLFLVPVL        60
     CSLHCSQGDG VEKQTIGAWV VHHGRKVAAD MRGAAEFSAI DLAAKSAGLL ARLGESDEAT       120
     LTSDQVIAAA KVGNLNPKTE LTACLDHLQK RKLIDRSASG DVSVLGVSGS SALTHAADLF       180
     EDNDPHPTER AAITLAELAS QAPVTANGAI EFLGDTHKLA KADATDFVLQ ASQIGFVDAE       240
     GEGADKLLFN GNLFRRDTAS KAKKVIDSLS SAEQAKIVEF DAKLKLRGAV TAATAIKILG       300
     EPLFAKVRAA ALYDMNIVSN EAGDHVFITS PGSFHKFSNP LTEDAFDHAK ALVAALTYGM       360
     THSPSARGQI WGIDLLLGKL IRGGSVGPAT AIGNDYRALE LERVVQTERS GYGFKMRLLK       420
     REVGVIALEV LKGRNAAAAA LETLPSAGMR SYTPPEAARV GLRKGQSAAS RAQTRSLLSA       480
     VRGGGSL                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page