(data stored in ACNUC7421 zone)

EMBL: AP010803.PE613

AP010803.PE613       Location/Qualifiers
FT   CDS             628903..630078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95447"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL5"
FT                   /protein_id="BAI95447.1"
FT                   /translation="MNAKPTSAPKKTGKKGFETEEIVRSYFLGAGFFVVRGVKLRHGGD
FT                   ELTDIDLWLYERSATLARRRIIIDIKDNAQPKAAERLFFVKGLAELIQVEATGIATSDS
FT                   RRSLRELARKHNVLWIDNADLQRLKSSQRLTASSRLSDEDLGELIAKVDASRSSKDVRD
FT                   TFASVKSSVADRFGPSCANTAADGAQYFARMCVEAHPNSLPAQVFTRLTYFCAGIAAAA
FT                   FDFASGESALRPQQERLASLTDAIRFGDDPKGTAEKLRWAQAAIRDYAPNGAGLADIIH
FT                   NRFHQALQSVPAESLAEIVVKMANSDRLFNAAKDLEQAAFLIDCPEFDELPIDARAFLG
FT                   AMLDFITIDRITFSQGWTPPKPVISAPAATEDANPTTSEATHPPTEDGKLL"
     MNAKPTSAPK KTGKKGFETE EIVRSYFLGA GFFVVRGVKL RHGGDELTDI DLWLYERSAT        60
     LARRRIIIDI KDNAQPKAAE RLFFVKGLAE LIQVEATGIA TSDSRRSLRE LARKHNVLWI       120
     DNADLQRLKS SQRLTASSRL SDEDLGELIA KVDASRSSKD VRDTFASVKS SVADRFGPSC       180
     ANTAADGAQY FARMCVEAHP NSLPAQVFTR LTYFCAGIAA AAFDFASGES ALRPQQERLA       240
     SLTDAIRFGD DPKGTAEKLR WAQAAIRDYA PNGAGLADII HNRFHQALQS VPAESLAEIV       300
     VKMANSDRLF NAAKDLEQAA FLIDCPEFDE LPIDARAFLG AMLDFITIDR ITFSQGWTPP       360
     KPVISAPAAT EDANPTTSEA THPPTEDGKL L                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page