(data stored in ACNUC7421 zone)

EMBL: AP010803.PE614

AP010803.PE614       Location/Qualifiers
FT   CDS             complement(630045..631586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95448"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL6"
FT                   /protein_id="BAI95448.1"
FT                   /translation="MGKGEHYRMQTRIHYVSAPAGSGKTYQLEQLAAKLATSENHKILI
FT                   AQPTRHLIRQTAANLRRANPALAVKSILSSSNGDAVTPRIEAHMANAGKGKGQVLLISH
FT                   EALKRLPPAHRAHWDLFVDEIPSVFECLALKIVKTHAHLTDHIELEDLGRGISAVKISP
FT                   GHRGAVEILLRNESKDELLERFGPISNHLLDDSRTVMVETACYQALLDGTKREGEINFF
FT                   SILGPEFVQDFNSVTLMGANARETELFALWGIRRDIDFVPHPLLTKGLRYHEHQNGDRL
FT                   TVHYLFEREWSISRSQTENDDTGMTLLEEVGDYIQRFFAGQRFLWVANKSADMMMFDRN
FT                   DRLPAVSHGLNEPHFIACHAVASTIALVHNHASAKFLAMLGLTDSQIRTVICYQSEYQA
FT                   IMRCSLRDPDAIAPVIIIVPSRASAEWIAGKFAGAAVSKLSTGLDWEVGKVGRPKAVRA
FT                   MTNAERVRKHRAAKKGGGGLTTSERRVGRLSGRLNGEAGWPACYPHNNLPSSVGG"
     MGKGEHYRMQ TRIHYVSAPA GSGKTYQLEQ LAAKLATSEN HKILIAQPTR HLIRQTAANL        60
     RRANPALAVK SILSSSNGDA VTPRIEAHMA NAGKGKGQVL LISHEALKRL PPAHRAHWDL       120
     FVDEIPSVFE CLALKIVKTH AHLTDHIELE DLGRGISAVK ISPGHRGAVE ILLRNESKDE       180
     LLERFGPISN HLLDDSRTVM VETACYQALL DGTKREGEIN FFSILGPEFV QDFNSVTLMG       240
     ANARETELFA LWGIRRDIDF VPHPLLTKGL RYHEHQNGDR LTVHYLFERE WSISRSQTEN       300
     DDTGMTLLEE VGDYIQRFFA GQRFLWVANK SADMMMFDRN DRLPAVSHGL NEPHFIACHA       360
     VASTIALVHN HASAKFLAML GLTDSQIRTV ICYQSEYQAI MRCSLRDPDA IAPVIIIVPS       420
     RASAEWIAGK FAGAAVSKLS TGLDWEVGKV GRPKAVRAMT NAERVRKHRA AKKGGGGLTT       480
     SERRVGRLSG RLNGEAGWPA CYPHNNLPSS VGG                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page