(data stored in ACNUC7421 zone)

EMBL: AP010803.PE615

AP010803.PE615       Location/Qualifiers
FT   CDS             complement(632138..633094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95449"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL7"
FT                   /protein_id="BAI95449.1"
FT                   /translation="MGIMGQPMNTNRRRKRRAPNLGFIAVWDDRWMDWPEIWAADLWFK
FT                   FLQISPSYELARQCRAGELMGAEALPADFDVVLAVYDDLGDVQISSGEWLDKQYRFMGH
FT                   FGKRPSTAQLGIVRHDGPEPAPDIMEGLEAYLAKQWIVEGKPSAVIAAIPLGMGKAEII
FT                   RQVEAMLDGMMPDSHVVADGSPKYQVADKRNDLRSAGRYCEAMRIKLRRPALKNWQIGV
FT                   MAKLSEAHSAYVKANPKRDPDDLIDRHGALKILTSRALSRGHMIAENAARGIFPSYATC
FT                   EHAMPLDWDFLHGQWRARSKKIAAEWYGARSLLVGHL"
     MGIMGQPMNT NRRRKRRAPN LGFIAVWDDR WMDWPEIWAA DLWFKFLQIS PSYELARQCR        60
     AGELMGAEAL PADFDVVLAV YDDLGDVQIS SGEWLDKQYR FMGHFGKRPS TAQLGIVRHD       120
     GPEPAPDIME GLEAYLAKQW IVEGKPSAVI AAIPLGMGKA EIIRQVEAML DGMMPDSHVV       180
     ADGSPKYQVA DKRNDLRSAG RYCEAMRIKL RRPALKNWQI GVMAKLSEAH SAYVKANPKR       240
     DPDDLIDRHG ALKILTSRAL SRGHMIAENA ARGIFPSYAT CEHAMPLDWD FLHGQWRARS       300
     KKIAAEWYGA RSLLVGHL                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page