(data stored in ACNUC7421 zone)

EMBL: AP010803.PE616

AP010803.PE616       Location/Qualifiers
FT   CDS             633186..633827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95450"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL8"
FT                   /protein_id="BAI95450.1"
FT                   /translation="MSDVSELLLVQRFDADRGWFDFEVEKQDDGSEVHYAAKRFGLLRD
FT                   DVSTGMDQLPAERILELIAAFKQKSLVADNEAQTKLRVAGRQILYQQLAEAYAFGLACF
FT                   SSIYNREHLTTVLSQHDLGKQAKALTSTGSYNKWNAITALLYGRWVNTDTDAPIADGEH
FT                   EGIANRAYRRDRSAEKYGCVLATLEGSKVSRPLTKSAVADSVRQWDCLAG"
     MSDVSELLLV QRFDADRGWF DFEVEKQDDG SEVHYAAKRF GLLRDDVSTG MDQLPAERIL        60
     ELIAAFKQKS LVADNEAQTK LRVAGRQILY QQLAEAYAFG LACFSSIYNR EHLTTVLSQH       120
     DLGKQAKALT STGSYNKWNA ITALLYGRWV NTDTDAPIAD GEHEGIANRA YRRDRSAEKY       180
     GCVLATLEGS KVSRPLTKSA VADSVRQWDC LAG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page