(data stored in SCRATCH zone)

EMBL: AP010803.PE618

AP010803.PE618       Location/Qualifiers
FT   CDS             635238..635843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95452"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM0"
FT                   /protein_id="BAI95452.1"
FT                   /translation="MDFITTAKFKSSEDGKVYGGILALEMHYRQWAAKQAAKRAKKPTP
FT                   RQIARRQQDRANAVAKAENPANDDVFEFAKPAQLSEAVEFGRIIFKVLGDKLFVVGVDG
FT                   WEQAKYDEFVIAKGRKILAREAEIQAGIDAKREGVKESAGAVLVNLRYDEDFSDLLADG
FT                   ADVEEVTAAFKATVADMKAKRLQKQTEHLEQFADPIPD"
     MDFITTAKFK SSEDGKVYGG ILALEMHYRQ WAAKQAAKRA KKPTPRQIAR RQQDRANAVA        60
     KAENPANDDV FEFAKPAQLS EAVEFGRIIF KVLGDKLFVV GVDGWEQAKY DEFVIAKGRK       120
     ILAREAEIQA GIDAKREGVK ESAGAVLVNL RYDEDFSDLL ADGADVEEVT AAFKATVADM       180
     KAKRLQKQTE HLEQFADPIP D                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page