(data stored in SCRATCH zone)

EMBL: AP010803.PE619

AP010803.PE619       Location/Qualifiers
FT   CDS             complement(635844..635978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95453"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM1"
FT                   /protein_id="BAI95453.1"
FT                   /translation="MVRQMKNAPTASRESVSKAVAGTHMRLHGLYMCYHTGAVADYVQ"
     MVRQMKNAPT ASRESVSKAV AGTHMRLHGL YMCYHTGAVA DYVQ                         44
//

If you have problems or comments...

PBIL Back to PBIL home page