(data stored in ACNUC7421 zone)

EMBL: AP010803.PE620

AP010803.PE620       Location/Qualifiers
FT   CDS             complement(636140..636382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95454"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM2"
FT                   /protein_id="BAI95454.1"
FT                   /translation="MSQRYKYGMRFYEFATTKPKKPRKPQKPMTPAQSMVAAKKRQVEL
FT                   AKQALQSVKDQQKRRKEAERTRQISYIEPLPKSAS"
     MSQRYKYGMR FYEFATTKPK KPRKPQKPMT PAQSMVAAKK RQVELAKQAL QSVKDQQKRR        60
     KEAERTRQIS YIEPLPKSAS                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page