(data stored in ACNUC7421 zone)

EMBL: AP010803.PE621

AP010803.PE621       Location/Qualifiers
FT   CDS             complement(636641..637831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06210"
FT                   /product="peptidase M23B"
FT                   /EC_number="3.4.24.75"
FT                   /note="membrane protein related to metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95455"
FT                   /db_xref="GOA:D4YYM3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM3"
FT                   /protein_id="BAI95455.1"
FT                   /translation="MGAAALWAGMTARCSKLCPDREIFLRSGGQVKFIHISRRAQLAAA
FT                   GLLSSALVGGIGFGLSVAASSAEIEQERAALAARDKAVSSSASQVARYRKSVDQLAQEL
FT                   QERQDFMDDLYRTHFGQDGTAPAGDVVGKADGGTKGGTSKLDTKISVAPEAAPLLRIDA
FT                   RQRRFAALLTGAVQKRADKAAAAIRSFGLNPDSLARSAARAQNRAMGGPFVPWEGQDVL
FT                   PGEFEKLAKALSRMEFLEASLLAIPSGKPTATPMMSSSYGYRSDPFNGHAAFHAGLDFP
FT                   GSMGQPILAAASGKVSFVGQRSGYGNVVEVTHGNGILTRYAHLSGFSARVGQQVARGGA
FT                   IARMGSTGRSTGPHLHFEVRVNGNAINPRRFLEARKDVLQIQQIATARLADVGDRG"
     MGAAALWAGM TARCSKLCPD REIFLRSGGQ VKFIHISRRA QLAAAGLLSS ALVGGIGFGL        60
     SVAASSAEIE QERAALAARD KAVSSSASQV ARYRKSVDQL AQELQERQDF MDDLYRTHFG       120
     QDGTAPAGDV VGKADGGTKG GTSKLDTKIS VAPEAAPLLR IDARQRRFAA LLTGAVQKRA       180
     DKAAAAIRSF GLNPDSLARS AARAQNRAMG GPFVPWEGQD VLPGEFEKLA KALSRMEFLE       240
     ASLLAIPSGK PTATPMMSSS YGYRSDPFNG HAAFHAGLDF PGSMGQPILA AASGKVSFVG       300
     QRSGYGNVVE VTHGNGILTR YAHLSGFSAR VGQQVARGGA IARMGSTGRS TGPHLHFEVR       360
     VNGNAINPRR FLEARKDVLQ IQQIATARLA DVGDRG                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page