(data stored in SCRATCH zone)

EMBL: AP010803.PE649

AP010803.PE649       Location/Qualifiers
FT   CDS             655381..655935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95483"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ1"
FT                   /protein_id="BAI95483.1"
FT                   /translation="MRKIVALGWAGAAMAAPAHSAVTASSDAGFAVENSVQVAADAATV
FT                   YRLLGQPGRWWNGAHSYSGSAANLRLEPVAGGCFCEALPGEEGRVGSVEHARVIHAAPD
FT                   RQLRLSGALGPLQAEAVTGTLTFDIAPSGKGVRVVMSYVVGGYIRMGAARIAPVVDKVL
FT                   AEQLAGLKRVAEQDAAGRTGL"
     MRKIVALGWA GAAMAAPAHS AVTASSDAGF AVENSVQVAA DAATVYRLLG QPGRWWNGAH        60
     SYSGSAANLR LEPVAGGCFC EALPGEEGRV GSVEHARVIH AAPDRQLRLS GALGPLQAEA       120
     VTGTLTFDIA PSGKGVRVVM SYVVGGYIRM GAARIAPVVD KVLAEQLAGL KRVAEQDAAG       180
     RTGL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page