(data stored in ACNUC7421 zone)

EMBL: AP010803.PE651

AP010803.PE651       Location/Qualifiers
FT   CDS             657358..657903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06510"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein with a bacterial SH3 domain
FT                   homologue / glycine rich secreted protein grsp-2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95485"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ3"
FT                   /protein_id="BAI95485.1"
FT                   /translation="MAWTGRRFLAAIGLAGALALGGCAYDDGYYGGVSVGSGYYRPGYY
FT                   GGWYDGYYYPGSGYYVYNRSGHRQRWSEGQRRYWEGRREARRDDGRRGNWNNGAPRQGW
FT                   RERSGGDGNRWSGNWRNARQGNPAAGAQAPRPGRGQGDMTTPRTERNWGTPRTRSDGGA
FT                   RSGGGGRSGREGWRGRRD"
     MAWTGRRFLA AIGLAGALAL GGCAYDDGYY GGVSVGSGYY RPGYYGGWYD GYYYPGSGYY        60
     VYNRSGHRQR WSEGQRRYWE GRREARRDDG RRGNWNNGAP RQGWRERSGG DGNRWSGNWR       120
     NARQGNPAAG AQAPRPGRGQ GDMTTPRTER NWGTPRTRSD GGARSGGGGR SGREGWRGRR       180
     D                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page