(data stored in ACNUC7421 zone)

EMBL: AP010803.PE652

AP010803.PE652       Location/Qualifiers
FT   CDS             657903..658571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95486"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ4"
FT                   /protein_id="BAI95486.1"
FT                   /translation="MRLGSSAVLALLLLAACDGREESAIDNLANGANAAQVENNFRAEA
FT                   QAVLEPLNPPAPGMPGGLPVDPQPVVEEGSIDPKGAQGAAQVVQGYYGLLEEKRYNDAQ
FT                   DLWNDNSAMGAEDDARFAARFRGFSEIHAQLGAPGAIEGAAGSLFVTVPVQVYGRLAAN
FT                   GKPWYRLRQVTLRRANDVPGSSEADRRWHIESIGPYAPPTEEAAETGNAISATDSLLKK
FT                   "
     MRLGSSAVLA LLLLAACDGR EESAIDNLAN GANAAQVENN FRAEAQAVLE PLNPPAPGMP        60
     GGLPVDPQPV VEEGSIDPKG AQGAAQVVQG YYGLLEEKRY NDAQDLWNDN SAMGAEDDAR       120
     FAARFRGFSE IHAQLGAPGA IEGAAGSLFV TVPVQVYGRL AANGKPWYRL RQVTLRRAND       180
     VPGSSEADRR WHIESIGPYA PPTEEAAETG NAISATDSLL KK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page