(data stored in ACNUC7421 zone)

EMBL: AP010803.PE655

AP010803.PE655       Location/Qualifiers
FT   CDS             660606..661004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06550"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95489"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ7"
FT                   /protein_id="BAI95489.1"
FT                   /translation="MPLHLTKIAFRSESPATLRAWLESHAEEARLTTRYLPKRVEELAD
FT                   GSLFWIHGHQLVGRSPLLGFQETGQGRYWIRLEPRLIPVRALPKRAHQGWRYLEDKDAP
FT                   PDLGSGEANDLDAMPTRLLGELSKLGLL"
     MPLHLTKIAF RSESPATLRA WLESHAEEAR LTTRYLPKRV EELADGSLFW IHGHQLVGRS        60
     PLLGFQETGQ GRYWIRLEPR LIPVRALPKR AHQGWRYLED KDAPPDLGSG EANDLDAMPT       120
     RLLGELSKLG LL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page