(data stored in ACNUC7421 zone)

EMBL: AP010803.PE657

AP010803.PE657       Location/Qualifiers
FT   CDS             complement(662421..662885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95491"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ9"
FT                   /protein_id="BAI95491.1"
FT                   /translation="MADASIFDRLKQDHDAHRQLFDKMADAQAEPDRLEKLFEQFRVEV
FT                   TAHAAAEEETLYATMLARPDLREDAQHSVSEHKEIDDYLEELEGLPFNGDEWNRVFAQM
FT                   KKRYLHHIEEEEEEMFPDAAKELTAEEEQKLAARFAQRKPAELQRAEAND"
     MADASIFDRL KQDHDAHRQL FDKMADAQAE PDRLEKLFEQ FRVEVTAHAA AEEETLYATM        60
     LARPDLREDA QHSVSEHKEI DDYLEELEGL PFNGDEWNRV FAQMKKRYLH HIEEEEEEMF       120
     PDAAKELTAE EEQKLAARFA QRKPAELQRA EAND                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page