(data stored in ACNUC7421 zone)

EMBL: AP010803.PE659

AP010803.PE659       Location/Qualifiers
FT   CDS             complement(663365..664612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06590"
FT                   /product="radical SAM protein"
FT                   /note="molybdenum cofactor biosynthesis enzyme / putative
FT                   DNA-binding protein with the helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95493"
FT                   /db_xref="GOA:D4YYR1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR1"
FT                   /protein_id="BAI95493.1"
FT                   /translation="MTALTTRQKLEILADAAKYDASCASSGTAKRDSASGRKGGIGSTE
FT                   GMGICHAYAPDGRCISLLKILLTNSCVFDCHYCVNRRSSDVRRARFTVREVVDLTLSFY
FT                   RRNYIEGLFLSSGIIRSSDYTMEQLVAVARSLREEHDFRGYIHLKTIPDADPELARQAG
FT                   LYADRLSINVELPTEQGLRRLAPEKDGQRIESAMAGMRDAIEDGSDASRRYAHAPRFAP
FT                   AGQSTQMIVGADQADDRAIIRRASALYSRHGLRRVYYSAFSPIPSPSSVLPLKRPPLMR
FT                   EHRLYQSDWMMRFYGYSAQELESAADPATGCLPLDIDPKLAWALRHRDCFPVDVNRAPR
FT                   EALLRVPGLGVKAVDRIVASRRHRRLRLDDVARLTRSVAKLRPFLVAADWRPVHLADRL
FT                   TLHIAHPPASQYELFP"
     MTALTTRQKL EILADAAKYD ASCASSGTAK RDSASGRKGG IGSTEGMGIC HAYAPDGRCI        60
     SLLKILLTNS CVFDCHYCVN RRSSDVRRAR FTVREVVDLT LSFYRRNYIE GLFLSSGIIR       120
     SSDYTMEQLV AVARSLREEH DFRGYIHLKT IPDADPELAR QAGLYADRLS INVELPTEQG       180
     LRRLAPEKDG QRIESAMAGM RDAIEDGSDA SRRYAHAPRF APAGQSTQMI VGADQADDRA       240
     IIRRASALYS RHGLRRVYYS AFSPIPSPSS VLPLKRPPLM REHRLYQSDW MMRFYGYSAQ       300
     ELESAADPAT GCLPLDIDPK LAWALRHRDC FPVDVNRAPR EALLRVPGLG VKAVDRIVAS       360
     RRHRRLRLDD VARLTRSVAK LRPFLVAADW RPVHLADRLT LHIAHPPASQ YELFP            415
//

If you have problems or comments...

PBIL Back to PBIL home page