(data stored in ACNUC7421 zone)

EMBL: AP010803.PE66

AP010803.PE66        Location/Qualifiers
FT   CDS             64191..64973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94900"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX18"
FT                   /protein_id="BAI94900.1"
FT                   /translation="MINNRQAGRRNRGRNNNNGRPNGGNRGGGDNGNRIDSRARGNAAQ
FT                   LLEKYKNMARDSQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQRFRPRDENFDDS
FT                   FDDFDAADEAGEDARADQATDRGQDFDRRRDEQRDYREGRNDRNRRDRNDRNERRRDRP
FT                   SVEEAAGEEVAEHRQAEAASEPVAAVQPAPEAQSEADAPRARRGRPRKAATKEEGQGGL
FT                   DLAVLPPSIARADNDADAAAEAPRKRTRRARPAAEAAE"
     MINNRQAGRR NRGRNNNNGR PNGGNRGGGD NGNRIDSRAR GNAAQLLEKY KNMARDSQMA        60
     GDRVNAEYYL QFADHYFRVL ADNRARQEEQ QQRFRPRDEN FDDSFDDFDA ADEAGEDARA       120
     DQATDRGQDF DRRRDEQRDY REGRNDRNRR DRNDRNERRR DRPSVEEAAG EEVAEHRQAE       180
     AASEPVAAVQ PAPEAQSEAD APRARRGRPR KAATKEEGQG GLDLAVLPPS IARADNDADA       240
     AAEAPRKRTR RARPAAEAAE                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page