(data stored in ACNUC7421 zone)

EMBL: AP010803.PE660

AP010803.PE660       Location/Qualifiers
FT   CDS             complement(664659..666530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06600"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95494"
FT                   /db_xref="GOA:D4YYR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR2"
FT                   /protein_id="BAI95494.1"
FT                   /translation="MPAIRPERSIFLLLLALLIVGLAVGSTYWLYAVQQRVNIWVQHTL
FT                   RVENQLSTLLLHVQEAESAQRGFMLTRKDSFLGPYEAFRGRWRQELAALRVEVRDNPPQ
FT                   ARSVEELEELLDDRLFLMRTGIERRRRGEIIPAGDFDAGMVTMARIRALVAAMRAREAQ
FT                   LLKGRTANDNRLSTMVSIGLAVSAVLITLLGAVALRTAYRRVAEATESQQALADINRRL
FT                   MSEAREREAAEGQLRQMQKMESIGQLTGGIAHDFNNMLAIVIGSLDIVRRRLAPGTDVR
FT                   IVRGVDNATEGAQRAAQLTARLLAFSRQQPLDPQPTDVNKLVGGMSELLRRTIGESIRV
FT                   EAVLAGGLWRASIDPSQLESAIINLCVNSRDAMPMGGKLTIETANAHLDDAYAAAHNDV
FT                   LAGQYVMVSVTDSGTGMPPEVVERAFDPFFTTKGVGKGTGLGLSQVFGFIKQSRGHVKI
FT                   YSEPGEGTIIKIYLPRHYGPEPVAGAVQAAPAELPRAKGEEIILVVEDEERVRHMSVDS
FT                   LRELGYTIVQASDGEQALEMLTIQPRIDMLFTDVVMPGINGRDLADRARASRPGLKILY
FT                   TTGYTRNAIVHNGMLDPGVSFLAKPFTLDQLAAKVRQVLDADPGESD"
     MPAIRPERSI FLLLLALLIV GLAVGSTYWL YAVQQRVNIW VQHTLRVENQ LSTLLLHVQE        60
     AESAQRGFML TRKDSFLGPY EAFRGRWRQE LAALRVEVRD NPPQARSVEE LEELLDDRLF       120
     LMRTGIERRR RGEIIPAGDF DAGMVTMARI RALVAAMRAR EAQLLKGRTA NDNRLSTMVS       180
     IGLAVSAVLI TLLGAVALRT AYRRVAEATE SQQALADINR RLMSEARERE AAEGQLRQMQ       240
     KMESIGQLTG GIAHDFNNML AIVIGSLDIV RRRLAPGTDV RIVRGVDNAT EGAQRAAQLT       300
     ARLLAFSRQQ PLDPQPTDVN KLVGGMSELL RRTIGESIRV EAVLAGGLWR ASIDPSQLES       360
     AIINLCVNSR DAMPMGGKLT IETANAHLDD AYAAAHNDVL AGQYVMVSVT DSGTGMPPEV       420
     VERAFDPFFT TKGVGKGTGL GLSQVFGFIK QSRGHVKIYS EPGEGTIIKI YLPRHYGPEP       480
     VAGAVQAAPA ELPRAKGEEI ILVVEDEERV RHMSVDSLRE LGYTIVQASD GEQALEMLTI       540
     QPRIDMLFTD VVMPGINGRD LADRARASRP GLKILYTTGY TRNAIVHNGM LDPGVSFLAK       600
     PFTLDQLAAK VRQVLDADPG ESD                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page