(data stored in ACNUC7421 zone)

EMBL: AP010803.PE675

AP010803.PE675       Location/Qualifiers
FT   CDS             678134..678544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06750"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95509"
FT                   /db_xref="GOA:D4YYS7"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS7"
FT                   /protein_id="BAI95509.1"
FT                   /translation="MPDAMSAPDPHPPAPQPLLIGAMAGACPQCGAPTLFSGPVRFAPS
FT                   CRACGMDYGQFNVGDGPAAFLTLIIGALMVAMALILELKVHPPLWLHLLLWTPLTVAAV
FT                   MGSLRVAKGALLILEYRNKAREGRLIARDREA"
     MPDAMSAPDP HPPAPQPLLI GAMAGACPQC GAPTLFSGPV RFAPSCRACG MDYGQFNVGD        60
     GPAAFLTLII GALMVAMALI LELKVHPPLW LHLLLWTPLT VAAVMGSLRV AKGALLILEY       120
     RNKAREGRLI ARDREA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page