(data stored in ACNUC7421 zone)

EMBL: AP010803.PE676

AP010803.PE676       Location/Qualifiers
FT   CDS             678541..679167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06760"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95510"
FT                   /db_xref="GOA:D4YYS8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS8"
FT                   /protein_id="BAI95510.1"
FT                   /translation="MSRRLPLIPTLIVAAAVLVMIGLGVWQLQRRAEKEATLALVAANP
FT                   AKPPVAFPAHPPVPPELLFRRSSAHCLRVVRWRSEAGRAADGSVGYRYIAECATGAEGP
FT                   GVLVAAGVAKTPDARPQWQGGQMRGWIGEEPDHRSLLSRIGGQAMPLRPMLIAGEPVPG
FT                   LKPLAPPTAADVPNNHLAYAGQWFFFAAIAAIIYLLALRRRTPRP"
     MSRRLPLIPT LIVAAAVLVM IGLGVWQLQR RAEKEATLAL VAANPAKPPV AFPAHPPVPP        60
     ELLFRRSSAH CLRVVRWRSE AGRAADGSVG YRYIAECATG AEGPGVLVAA GVAKTPDARP       120
     QWQGGQMRGW IGEEPDHRSL LSRIGGQAMP LRPMLIAGEP VPGLKPLAPP TAADVPNNHL       180
     AYAGQWFFFA AIAAIIYLLA LRRRTPRP                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page