(data stored in ACNUC7421 zone)

EMBL: AP010803.PE68

AP010803.PE68        Location/Qualifiers
FT   CDS             complement(65447..65746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94902"
FT                   /db_xref="GOA:D4YX20"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX20"
FT                   /protein_id="BAI94902.1"
FT                   /translation="MTRRQALDDPEIARVAWRRFRRIMAWMALTGALCVGAALLFLRWW
FT                   AGPMPIHMVIATILGVWLTFMLGTGLMALAFLSSGTGHDEQIIDRMKDEVPDND"
     MTRRQALDDP EIARVAWRRF RRIMAWMALT GALCVGAALL FLRWWAGPMP IHMVIATILG        60
     VWLTFMLGTG LMALAFLSSG TGHDEQIIDR MKDEVPDND                               99
//

If you have problems or comments...

PBIL Back to PBIL home page