(data stored in SCRATCH zone)

EMBL: AP010803.PE680

AP010803.PE680       Location/Qualifiers
FT   CDS             complement(682199..682873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95514"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT2"
FT                   /protein_id="BAI95514.1"
FT                   /translation="MKARAALLALTLPALVGARPPMRYQPDPSSVFAAELAFNRLAQQK
FT                   GQWTAFRETAADEAVMFVPQRVLAKQWLKGRADPPAPVSWTPSAIYVSCDGDLAASTGG
FT                   WKRPDGSVGYFTTIWQRDRKGEWKWVMDHGDTLASAREAPEFLIGKVATCKRSLAGGAP
FT                   RPASPPPGRKAAKGEMPTAPRDESLSWNAEAAADGSRRVTVRMWNGTDYETVIDDRVAA
FT                   AP"
     MKARAALLAL TLPALVGARP PMRYQPDPSS VFAAELAFNR LAQQKGQWTA FRETAADEAV        60
     MFVPQRVLAK QWLKGRADPP APVSWTPSAI YVSCDGDLAA STGGWKRPDG SVGYFTTIWQ       120
     RDRKGEWKWV MDHGDTLASA REAPEFLIGK VATCKRSLAG GAPRPASPPP GRKAAKGEMP       180
     TAPRDESLSW NAEAAADGSR RVTVRMWNGT DYETVIDDRV AAAP                        224
//

If you have problems or comments...

PBIL Back to PBIL home page