(data stored in SCRATCH zone)

EMBL: AP010803.PE682

AP010803.PE682       Location/Qualifiers
FT   CDS             complement(683778..684089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06820"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95516"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT4"
FT                   /protein_id="BAI95516.1"
FT                   /translation="MTVWSRDGDDLILSVRLTPGAAREEVGGVWTDDKGANWLSARVRA
FT                   VPERGKANAALIALLAKRLDWPRGAISLESGDANRLKRLRIKGGGEALASGRLSTIIE"
     MTVWSRDGDD LILSVRLTPG AAREEVGGVW TDDKGANWLS ARVRAVPERG KANAALIALL        60
     AKRLDWPRGA ISLESGDANR LKRLRIKGGG EALASGRLST IIE                         103
//

If you have problems or comments...

PBIL Back to PBIL home page