(data stored in ACNUC7421 zone)

EMBL: AP010803.PE683

AP010803.PE683       Location/Qualifiers
FT   CDS             complement(684086..684376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06830"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95517"
FT                   /db_xref="GOA:D4YYT5"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT5"
FT                   /protein_id="BAI95517.1"
FT                   /translation="MAYALYQIIVILLDVLWWIIIIQAIMSWLIAFNVVNLSNDFVRTV
FT                   MVALDRMTAPIYNPIRRVLPDLGALDLSPMVVLLGILIIRQAILPPLFGLV"
     MAYALYQIIV ILLDVLWWII IIQAIMSWLI AFNVVNLSND FVRTVMVALD RMTAPIYNPI        60
     RRVLPDLGAL DLSPMVVLLG ILIIRQAILP PLFGLV                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page