(data stored in ACNUC7421 zone)

EMBL: AP010803.PE69

AP010803.PE69        Location/Qualifiers
FT   CDS             65822..66250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00690"
FT                   /product="CBS domain protein"
FT                   /note="FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94903"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX21"
FT                   /protein_id="BAI94903.1"
FT                   /translation="MTIAAILQRKGQDVVQVQSSDTVLSVVRLLAQRRIGCVPVVDDGE
FT                   VVGIFSERDLAYRVAQEGAAVLDRPVGEIMTAPAITTDDRTPVNHCLSLMTKRRIRHLP
FT                   VVVDGALVGLVSIGDLVKFRIDSIESEAAALRDYIQTA"
     MTIAAILQRK GQDVVQVQSS DTVLSVVRLL AQRRIGCVPV VDDGEVVGIF SERDLAYRVA        60
     QEGAAVLDRP VGEIMTAPAI TTDDRTPVNH CLSLMTKRRI RHLPVVVDGA LVGLVSIGDL       120
     VKFRIDSIES EAAALRDYIQ TA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page