(data stored in ACNUC7421 zone)

EMBL: AP010803.PE695

AP010803.PE695       Location/Qualifiers
FT   CDS             complement(698124..698906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06950"
FT                   /product="putative lipolytic enzyme"
FT                   /EC_number="3.1.2.-"
FT                   /note="lipolytic enzyme, G-D-S-L family/lysophospholipase
FT                   L1 or related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95529"
FT                   /db_xref="GOA:D4YYU7"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU7"
FT                   /protein_id="BAI95529.1"
FT                   /translation="MRTANINSVRCIGIKVASALLGLGLLIGPGGALRAAEPQIPAPTI
FT                   PAPRINADPAFPFSREIEAFAKANEAGPAVADATLFLGSSSIRLWDIGGSFPDIGTVNR
FT                   GFGGATTPDVLHYYKRLLPRAKPRSILVYVGENDLAAGASPGEVANNVLTLLRQLRTDY
FT                   PKAHIAYLSLKPSPIRWTLWPKMAAVNMTVAARSRVTRFDYLDVGRVLLAADGLPDASL
FT                   FRPDGLHMNPRGYMLWTQLVDAYLDEAVAAERKPVSPS"
     MRTANINSVR CIGIKVASAL LGLGLLIGPG GALRAAEPQI PAPTIPAPRI NADPAFPFSR        60
     EIEAFAKANE AGPAVADATL FLGSSSIRLW DIGGSFPDIG TVNRGFGGAT TPDVLHYYKR       120
     LLPRAKPRSI LVYVGENDLA AGASPGEVAN NVLTLLRQLR TDYPKAHIAY LSLKPSPIRW       180
     TLWPKMAAVN MTVAARSRVT RFDYLDVGRV LLAADGLPDA SLFRPDGLHM NPRGYMLWTQ       240
     LVDAYLDEAV AAERKPVSPS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page