(data stored in SCRATCH zone)

EMBL: AP010803.PE696

AP010803.PE696       Location/Qualifiers
FT   CDS             complement(698863..699234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06960"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95530"
FT                   /db_xref="GOA:D4YYU8"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU8"
FT                   /protein_id="BAI95530.1"
FT                   /translation="MNDMIQIFGPDVTAPPIVHARFSLGDVVQHRLFGFRGVVFDIDPV
FT                   FANTEEWYQAIPEEVRPDKHQPFYHLLAENGESSYVAYVSQQNLVADDSEEPVDHPAIS
FT                   GMFGTYANGKYQLRPLHRH"
     MNDMIQIFGP DVTAPPIVHA RFSLGDVVQH RLFGFRGVVF DIDPVFANTE EWYQAIPEEV        60
     RPDKHQPFYH LLAENGESSY VAYVSQQNLV ADDSEEPVDH PAISGMFGTY ANGKYQLRPL       120
     HRH                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page