(data stored in SCRATCH zone)

EMBL: AP010803.PE697

AP010803.PE697       Location/Qualifiers
FT   CDS             699799..700092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95531"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU9"
FT                   /protein_id="BAI95531.1"
FT                   /translation="MGRIRPGGEALDDPSCAHEGSARACHSLVSPGTRYPSDKPEAVDR
FT                   VGRSRQATKRHFLPLALSSRQLKRTSPRMHLLHGGRNKSGHTFICSRAVAIG"
     MGRIRPGGEA LDDPSCAHEG SARACHSLVS PGTRYPSDKP EAVDRVGRSR QATKRHFLPL        60
     ALSSRQLKRT SPRMHLLHGG RNKSGHTFIC SRAVAIG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page