(data stored in SCRATCH zone)

EMBL: AP010803.PE698

AP010803.PE698       Location/Qualifiers
FT   CDS             complement(700146..701333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06980"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95532"
FT                   /db_xref="GOA:D4YYV0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV0"
FT                   /protein_id="BAI95532.1"
FT                   /translation="MTANIYARIDPQKESRWLRLIGSLRIIPLVSAGVIAFFIWSYFGV
FT                   LDEVAVGPGKVTPPSRSQVIQSLEGGIVNGIFVHEGDIVKPRQQLATLDRARFSSMLGE
FT                   AEAKARALEAAAARLEAEINGGMPRFSADVQALPALVAREMQLLRSRRENLEVATASLR
FT                   QSLALTRRQLAMTEPLVDLGAANRVEIIQLQRQENELQAKLDSLRNQYVIDANAEYAKT
FT                   RSELDVIDQVIGGRRDQLNRTRLISPVRGIVKNLEVTTIGGVIQPGGSLMEIVPLEDEL
FT                   LVEARISPRDIAFIRPGQPATVKITAYDPSIYGTLDGTVDRISPDTLQDEVNREQVYYR
FT                   VYVRTRHSSLRTKDGREHAIMPGMVANVEIRTGRKTVLQYLLKPINKAKEAMRER"
     MTANIYARID PQKESRWLRL IGSLRIIPLV SAGVIAFFIW SYFGVLDEVA VGPGKVTPPS        60
     RSQVIQSLEG GIVNGIFVHE GDIVKPRQQL ATLDRARFSS MLGEAEAKAR ALEAAAARLE       120
     AEINGGMPRF SADVQALPAL VAREMQLLRS RRENLEVATA SLRQSLALTR RQLAMTEPLV       180
     DLGAANRVEI IQLQRQENEL QAKLDSLRNQ YVIDANAEYA KTRSELDVID QVIGGRRDQL       240
     NRTRLISPVR GIVKNLEVTT IGGVIQPGGS LMEIVPLEDE LLVEARISPR DIAFIRPGQP       300
     ATVKITAYDP SIYGTLDGTV DRISPDTLQD EVNREQVYYR VYVRTRHSSL RTKDGREHAI       360
     MPGMVANVEI RTGRKTVLQY LLKPINKAKE AMRER                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page