(data stored in ACNUC7421 zone)

EMBL: AP010803.PE699

AP010803.PE699       Location/Qualifiers
FT   CDS             complement(701330..703477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06990"
FT                   /product="putative type I secretion protein ATP-binding
FT                   protein"
FT                   /note="ABC-type bacteriocin/lantibiotic exporter, contain
FT                   an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95533"
FT                   /db_xref="GOA:D4YYV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV1"
FT                   /protein_id="BAI95533.1"
FT                   /translation="MADFSDVSDNPWVSAIARLATLKGVQVTSSELMTRLYWSPDADME
FT                   QLLVHAARLSGIRFEIIQMAIDTIPAMLLPAIVELRDGRSVLLLSRDGDSARITMPALR
FT                   RDAPTDISLAELQVQATGRIGFVEPLSTKSRDARLDEFLRKPSRSWLWDVIMGDRRGYG
FT                   EVMIGSLVGNLLTFATSLFAMQVWDRVIPAQSLPTLWVLALGAGMALLLELMLRTARVQ
FT                   LVDRIGRRADLEISARVFARALDIRNDARPRSTGALITQLRDIEQVREMLTSTTVGALI
FT                   DLPFIILFLALFTLLAGPLTFVLIGAAALIVVPGILLQRPLARLAGEGMREAALRNAIL
FT                   VESIERIDEIKAAQAEPRFQSMWERLTLANTRVGAEQRFVAAFFTNWTQTLQQLAYTVV
FT                   ILAGAFRVMSGDMTMGAVIACSILTSRALVLFVPFGQIFTRWQNAKVALAGLDDLLAKP
FT                   VDHDPEQGLLRRSGLRGHYEARDLRFAYDPESAPALTIDRLTISAGERVALLGRIGAGK
FT                   STLLRLLAGLARPTGGDLLLDGTAMTLINPVDVRRDTGYLGQGAQLFLGTIRENLLIGA
FT                   PGATDDQILEALRVSGGLPLLQSQPKGLDLLLQEGGAGLSGGQRQTLLLARVLLRNSNI
FT                   LLLDEPTAPLDEISERNLVAQLGAWLVGRTLIVTTNRPGLLELVDRIIVIDGGRVTVDG
FT                   PKTRVLAQLQRPPVSRAEQNR"
     MADFSDVSDN PWVSAIARLA TLKGVQVTSS ELMTRLYWSP DADMEQLLVH AARLSGIRFE        60
     IIQMAIDTIP AMLLPAIVEL RDGRSVLLLS RDGDSARITM PALRRDAPTD ISLAELQVQA       120
     TGRIGFVEPL STKSRDARLD EFLRKPSRSW LWDVIMGDRR GYGEVMIGSL VGNLLTFATS       180
     LFAMQVWDRV IPAQSLPTLW VLALGAGMAL LLELMLRTAR VQLVDRIGRR ADLEISARVF       240
     ARALDIRNDA RPRSTGALIT QLRDIEQVRE MLTSTTVGAL IDLPFIILFL ALFTLLAGPL       300
     TFVLIGAAAL IVVPGILLQR PLARLAGEGM REAALRNAIL VESIERIDEI KAAQAEPRFQ       360
     SMWERLTLAN TRVGAEQRFV AAFFTNWTQT LQQLAYTVVI LAGAFRVMSG DMTMGAVIAC       420
     SILTSRALVL FVPFGQIFTR WQNAKVALAG LDDLLAKPVD HDPEQGLLRR SGLRGHYEAR       480
     DLRFAYDPES APALTIDRLT ISAGERVALL GRIGAGKSTL LRLLAGLARP TGGDLLLDGT       540
     AMTLINPVDV RRDTGYLGQG AQLFLGTIRE NLLIGAPGAT DDQILEALRV SGGLPLLQSQ       600
     PKGLDLLLQE GGAGLSGGQR QTLLLARVLL RNSNILLLDE PTAPLDEISE RNLVAQLGAW       660
     LVGRTLIVTT NRPGLLELVD RIIVIDGGRV TVDGPKTRVL AQLQRPPVSR AEQNR            715
//

If you have problems or comments...

PBIL Back to PBIL home page