(data stored in ACNUC7421 zone)

EMBL: AP010803.PE700

AP010803.PE700       Location/Qualifiers
FT   CDS             complement(703470..704579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07000"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95534"
FT                   /db_xref="GOA:D4YYV2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV2"
FT                   /protein_id="BAI95534.1"
FT                   /translation="MNKAGYQANLGPNMFSRSSGSGLNDNMAGPSLYLQQRIWDFGRAK
FT                   GEIGYARSTEEQRRYELESVADQLAEQAALAFLQVKRFELLGREAARQVEALEHLRELI
FT                   GLRVDAGISDKSDLMLANVRVDSARGDAILAESSLITARAALANLTGAMPTVYQDPNPQ
FT                   ITRFGAAEEEPDFASLPAIVAADKAEQAAAARVGQAKAERYPQLGLQLGYTRNNYTYNE
FT                   RNNAFSALVTVTGDLYKRGTRYQVRAAEEERRAARSARDSVLLDARGRALTARQEIRGG
FT                   ALRIEAFSHQEKQAEEASRIFFEEYKLGKRTLTELLNTQLEIYRAASARIVAEYDVLAA
FT                   RIRFENVRGTLRPSLGLPARLTEGEEEHG"
     MNKAGYQANL GPNMFSRSSG SGLNDNMAGP SLYLQQRIWD FGRAKGEIGY ARSTEEQRRY        60
     ELESVADQLA EQAALAFLQV KRFELLGREA ARQVEALEHL RELIGLRVDA GISDKSDLML       120
     ANVRVDSARG DAILAESSLI TARAALANLT GAMPTVYQDP NPQITRFGAA EEEPDFASLP       180
     AIVAADKAEQ AAAARVGQAK AERYPQLGLQ LGYTRNNYTY NERNNAFSAL VTVTGDLYKR       240
     GTRYQVRAAE EERRAARSAR DSVLLDARGR ALTARQEIRG GALRIEAFSH QEKQAEEASR       300
     IFFEEYKLGK RTLTELLNTQ LEIYRAASAR IVAEYDVLAA RIRFENVRGT LRPSLGLPAR       360
     LTEGEEEHG                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page