(data stored in SCRATCH zone)

EMBL: AP010803.PE702

AP010803.PE702       Location/Qualifiers
FT   CDS             complement(706510..713289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07020"
FT                   /product="large repetitive protein"
FT                   /note="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95536"
FT                   /db_xref="GOA:D4YYV4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV4"
FT                   /protein_id="BAI95536.1"
FT                   /translation="MDKHVEIQQRGSKLPEKTAVTDRNAVVSVQPQSVIKVVAPPNSVS
FT                   SMLREGDDLIIHFADGSTIRLDGYFACPTEDISQLFVADPASAGEWLVSFTDAACGLAT
FT                   DATSQALSYAYTPMASGIGAAAAAGGGISDGLLAGLGALVLGGGIAAAAGGGGSNRGPA
FT                   GPVDQTPPAAPAISPSNGRSLSGTAEAGATVRIDLDANGSIDASVTADANGNWTYTPPN
FT                   PIANGTRISVTAVDSAGNVSTPSQITVDAAAPAAPTIDPTDGTMLNGSAEAGSTVNIDL
FT                   NGDGAPDASVVAGTDGRWAYTPAAPLVDGTTVTVTATDAVGNVSPPTSLTLDLSAPAAP
FT                   VLVTLTDDVGAIIGGIASGGATDDRQPTLGGTAEAGAKLSIYDGNVLLGETTADANGAW
FT                   SFTPAAPLAEGAHIISVTATDAAGNISAASPPFAFAVDTIAPAAPVLGPTDGTTISGTA
FT                   EIGATIELDTDGDGIADATTTADANGEWRIILPTSLANGTQVSATATDAAGNRSGPGSA
FT                   IVDTGLDTTPPAIPILGSVTDDVDPAQGPLSNGGATNDVRPLLAGGGVEAGATISIYDG
FT                   GTVIGTTTADGAGNWTFTPTDALGEGAHSLTVTATDAFGNESDASPAFVLTVDTVAPDT
FT                   PTIRPSNGAGLSGMAEPGATINLDLNGDGTVDVTVTADGTGEWQYVPDARLPDGATVIV
FT                   TASDPAGNLSPPASRVVDADVPVAPVITGIVDDVAPIIGGLANGASSNDVQPTFSGTAE
FT                   AGSTVYLYDNGAQIGTAAADGSGNWTFTPAALTDGAHSFSVTATDEAGNISGPSSPFVI
FT                   TVDTAAPAAPAMNPTDGNTISGTAEAGATIAIDINGDGAADATTTANSAGEWSVGLGTP
FT                   LGNGTLVSATASDSAGNSSGPSTVTVTTAIDSTPPPIPTFDSATDDVAPVLSALSSGAT
FT                   SNDTQPLLAGSGVEAGATVSIYDNGVLLGNGTVDGSGNWTFTPGAPLSEGAHSLTVTAT
FT                   DGSGNESAASAPFLLTIDTAAPGAPTISPSNGDVLTGTAEAGATINIDLDGNGSADTSV
FT                   TADPSGNWTFDPIGVVPDGTTVIVTASDAAGNVSGPASTVIDAIAPAAPAITALTDDQG
FT                   GSTGGISPGAATDDDRPAIAGTADIGATVLLFDNGTQIGTAAVDGSGNWAFTPAIALPD
FT                   GPHSFSARAVDAAGNVSSLSASFAITIDTLSPNAGAITGISDNVPGAIGPIPNGSLTND
FT                   AQPTLSGTADPGESVTIMDNGVAIGTAPVDGLGAWSFTPLAPLSDGAHSFTIVTVDAAG
FT                   NGSSASTAYAVTIDSAAPAAPVIDAAADNSGSITGTVAAGGSTDEVQPTLSGTVEPGST
FT                   VAIFSNGTPAGNASVDPAGNWTFTPALPLGDGTYNFTAVATDPAGNSSGLSSPFTITID
FT                   TAAPSLPIITQASDDVGGAPTPIAPGGLTDDALPVLSGTTEALATVTIFDNGTAIGTTT
FT                   ADGSGNWTFTPGSPLALGAHSITASAIDAVGNESLQGAPFNFTLIAVAGGIPVIGGVSD
FT                   DVGAVNGPVLNGGVTDDATPTLSGTGPASTTLAIFDNGTQIGTASTDGSGAWSFTPTTA
FT                   LTDGTHDLTAAEALGGGAFGPASGAFTINVDTAAPAAPAITVAIDDVAAFTGGITDGGL
FT                   TNDSAPEIRGTGEIGATVTLFDNGSPVGTAVVDASGNWSISPVGPLAEGLHSFTASAAD
FT                   EAGNAGPLSAAFTLTVDLTPPPAPTITAVTDDVAQQTGTVTNGGISNDVLPQISGTAIA
FT                   GSTVQIFDNGALLGTTVADGGGNWSFTPGGALANGSHGFTVAQLDSAGNASSPSPVYSV
FT                   TIDTVAPTAGIAITTLTQDTGVVGDWSTQDSAPTIAGTLTAPLSAGERVEIQIDGGAWV
FT                   SATASGTSWFYGPGTLAVGQHGVNVRVIDSAGNIGDVEAQQFTITNVNQAPIVQASGTS
FT                   LLGLVGAEALGLIDLSTQSLTAYDPNNNLRSVEVRFAPLLSANLGAFTLTASTALAAEL
FT                   GLQVSIANNPGLLGILAPSSVLTVTALDGGPISNQAINELLNTVHFNQDLTLLGLNVLD
FT                   TTTITATDMNGLTASSATGTLANLSLLNASGSSAVLEGNASANTINGTAANERLYGHGG
FT                   ADTLNGNGGNDLLRGGAGADTLNGGTGNDVLVHDAADASIDGGTGVDTLLIDSGTGMVL
FT                   NLDAVNNIRNIERIDLGVGDAGRQITLTEAGIIRATEASHQLIVTGDLNDSVTMTGATL
FT                   QGQTLINGQAFDHYALGTTNIYVEDPVMVVV"
     MDKHVEIQQR GSKLPEKTAV TDRNAVVSVQ PQSVIKVVAP PNSVSSMLRE GDDLIIHFAD        60
     GSTIRLDGYF ACPTEDISQL FVADPASAGE WLVSFTDAAC GLATDATSQA LSYAYTPMAS       120
     GIGAAAAAGG GISDGLLAGL GALVLGGGIA AAAGGGGSNR GPAGPVDQTP PAAPAISPSN       180
     GRSLSGTAEA GATVRIDLDA NGSIDASVTA DANGNWTYTP PNPIANGTRI SVTAVDSAGN       240
     VSTPSQITVD AAAPAAPTID PTDGTMLNGS AEAGSTVNID LNGDGAPDAS VVAGTDGRWA       300
     YTPAAPLVDG TTVTVTATDA VGNVSPPTSL TLDLSAPAAP VLVTLTDDVG AIIGGIASGG       360
     ATDDRQPTLG GTAEAGAKLS IYDGNVLLGE TTADANGAWS FTPAAPLAEG AHIISVTATD       420
     AAGNISAASP PFAFAVDTIA PAAPVLGPTD GTTISGTAEI GATIELDTDG DGIADATTTA       480
     DANGEWRIIL PTSLANGTQV SATATDAAGN RSGPGSAIVD TGLDTTPPAI PILGSVTDDV       540
     DPAQGPLSNG GATNDVRPLL AGGGVEAGAT ISIYDGGTVI GTTTADGAGN WTFTPTDALG       600
     EGAHSLTVTA TDAFGNESDA SPAFVLTVDT VAPDTPTIRP SNGAGLSGMA EPGATINLDL       660
     NGDGTVDVTV TADGTGEWQY VPDARLPDGA TVIVTASDPA GNLSPPASRV VDADVPVAPV       720
     ITGIVDDVAP IIGGLANGAS SNDVQPTFSG TAEAGSTVYL YDNGAQIGTA AADGSGNWTF       780
     TPAALTDGAH SFSVTATDEA GNISGPSSPF VITVDTAAPA APAMNPTDGN TISGTAEAGA       840
     TIAIDINGDG AADATTTANS AGEWSVGLGT PLGNGTLVSA TASDSAGNSS GPSTVTVTTA       900
     IDSTPPPIPT FDSATDDVAP VLSALSSGAT SNDTQPLLAG SGVEAGATVS IYDNGVLLGN       960
     GTVDGSGNWT FTPGAPLSEG AHSLTVTATD GSGNESAASA PFLLTIDTAA PGAPTISPSN      1020
     GDVLTGTAEA GATINIDLDG NGSADTSVTA DPSGNWTFDP IGVVPDGTTV IVTASDAAGN      1080
     VSGPASTVID AIAPAAPAIT ALTDDQGGST GGISPGAATD DDRPAIAGTA DIGATVLLFD      1140
     NGTQIGTAAV DGSGNWAFTP AIALPDGPHS FSARAVDAAG NVSSLSASFA ITIDTLSPNA      1200
     GAITGISDNV PGAIGPIPNG SLTNDAQPTL SGTADPGESV TIMDNGVAIG TAPVDGLGAW      1260
     SFTPLAPLSD GAHSFTIVTV DAAGNGSSAS TAYAVTIDSA APAAPVIDAA ADNSGSITGT      1320
     VAAGGSTDEV QPTLSGTVEP GSTVAIFSNG TPAGNASVDP AGNWTFTPAL PLGDGTYNFT      1380
     AVATDPAGNS SGLSSPFTIT IDTAAPSLPI ITQASDDVGG APTPIAPGGL TDDALPVLSG      1440
     TTEALATVTI FDNGTAIGTT TADGSGNWTF TPGSPLALGA HSITASAIDA VGNESLQGAP      1500
     FNFTLIAVAG GIPVIGGVSD DVGAVNGPVL NGGVTDDATP TLSGTGPAST TLAIFDNGTQ      1560
     IGTASTDGSG AWSFTPTTAL TDGTHDLTAA EALGGGAFGP ASGAFTINVD TAAPAAPAIT      1620
     VAIDDVAAFT GGITDGGLTN DSAPEIRGTG EIGATVTLFD NGSPVGTAVV DASGNWSISP      1680
     VGPLAEGLHS FTASAADEAG NAGPLSAAFT LTVDLTPPPA PTITAVTDDV AQQTGTVTNG      1740
     GISNDVLPQI SGTAIAGSTV QIFDNGALLG TTVADGGGNW SFTPGGALAN GSHGFTVAQL      1800
     DSAGNASSPS PVYSVTIDTV APTAGIAITT LTQDTGVVGD WSTQDSAPTI AGTLTAPLSA      1860
     GERVEIQIDG GAWVSATASG TSWFYGPGTL AVGQHGVNVR VIDSAGNIGD VEAQQFTITN      1920
     VNQAPIVQAS GTSLLGLVGA EALGLIDLST QSLTAYDPNN NLRSVEVRFA PLLSANLGAF      1980
     TLTASTALAA ELGLQVSIAN NPGLLGILAP SSVLTVTALD GGPISNQAIN ELLNTVHFNQ      2040
     DLTLLGLNVL DTTTITATDM NGLTASSATG TLANLSLLNA SGSSAVLEGN ASANTINGTA      2100
     ANERLYGHGG ADTLNGNGGN DLLRGGAGAD TLNGGTGNDV LVHDAADASI DGGTGVDTLL      2160
     IDSGTGMVLN LDAVNNIRNI ERIDLGVGDA GRQITLTEAG IIRATEASHQ LIVTGDLNDS      2220
     VTMTGATLQG QTLINGQAFD HYALGTTNIY VEDPVMVVV                             2259
//

If you have problems or comments...

PBIL Back to PBIL home page