(data stored in SCRATCH zone)

EMBL: AP010803.PE704

AP010803.PE704       Location/Qualifiers
FT   CDS             714165..714665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07040"
FT                   /product="spore coat protein U"
FT                   /note="uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95538"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV6"
FT                   /protein_id="BAI95538.1"
FT                   /translation="MDHCAKRLMTAITMAALCAISPGQAATTTTTFPVTASVLTACAVS
FT                   ANPLNFGNYDPTSATPLDATTNLSVLCTVGTSFTVGLNAGAASGATVTARRMVNGANIL
FT                   NYALYREAARTNIWGNTPGTDMPPATTAPILPTALTVYGRIPAGQNVPAGGYADTVTVT
FT                   VNY"
     MDHCAKRLMT AITMAALCAI SPGQAATTTT TFPVTASVLT ACAVSANPLN FGNYDPTSAT        60
     PLDATTNLSV LCTVGTSFTV GLNAGAASGA TVTARRMVNG ANILNYALYR EAARTNIWGN       120
     TPGTDMPPAT TAPILPTALT VYGRIPAGQN VPAGGYADTV TVTVNY                      166
//

If you have problems or comments...

PBIL Back to PBIL home page