(data stored in ACNUC7421 zone)

EMBL: AP010803.PE72

AP010803.PE72        Location/Qualifiers
FT   CDS             74915..76531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00720"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94906"
FT                   /db_xref="GOA:D4YX24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX24"
FT                   /protein_id="BAI94906.1"
FT                   /translation="MIFGRIKPLDAILATAEKKSLVRTLGPVQLTLLGVGAIIGTGIFV
FT                   LTAAAAQKAGPGMMWSFVIAGAVCAFAALCYSEIASMVPVSGSAYTYTYAVVGELLAWM
FT                   VGWALILEYAVAASAVSVGWSGYFMGLLKSITGLELPQALSAGPVWTMNGLVPHADITH
FT                   GLINIPAIVIALAVTALLVIGTTESARVNAVLVAIKVTALTAFILLTLPVLDTGNFSPF
FT                   APNGWFGPEGASGMGIVGAAASIFFAYVGFDAVSTAAEETKNPQRNVPIGLIGSLALCT
FT                   VFYLLVAGGAIGAIGAQPVLGPDGSVVAPGSQGFAAACATAAHAQDLVCSNEALAHVLR
FT                   EINWTVVGNALGLAANLALPSVILMMMFGQTRIFFVMARDGLLPEKLASIHPRFKTPHV
FT                   VTMVTGVFVAIGAALLPVGQLADISNSGTLFAFFMVSIAVLVLRVKEPGRARPFRTPLV
FT                   WVIAPMAAFGCVFLFFNLPFDAQLVLPIWGGIGLVLYFIYGYRKSHVGRGLVETHEQDA
FT                   GIPPQPVPPMPGAHTPGGRDA"
     MIFGRIKPLD AILATAEKKS LVRTLGPVQL TLLGVGAIIG TGIFVLTAAA AQKAGPGMMW        60
     SFVIAGAVCA FAALCYSEIA SMVPVSGSAY TYTYAVVGEL LAWMVGWALI LEYAVAASAV       120
     SVGWSGYFMG LLKSITGLEL PQALSAGPVW TMNGLVPHAD ITHGLINIPA IVIALAVTAL       180
     LVIGTTESAR VNAVLVAIKV TALTAFILLT LPVLDTGNFS PFAPNGWFGP EGASGMGIVG       240
     AAASIFFAYV GFDAVSTAAE ETKNPQRNVP IGLIGSLALC TVFYLLVAGG AIGAIGAQPV       300
     LGPDGSVVAP GSQGFAAACA TAAHAQDLVC SNEALAHVLR EINWTVVGNA LGLAANLALP       360
     SVILMMMFGQ TRIFFVMARD GLLPEKLASI HPRFKTPHVV TMVTGVFVAI GAALLPVGQL       420
     ADISNSGTLF AFFMVSIAVL VLRVKEPGRA RPFRTPLVWV IAPMAAFGCV FLFFNLPFDA       480
     QLVLPIWGGI GLVLYFIYGY RKSHVGRGLV ETHEQDAGIP PQPVPPMPGA HTPGGRDA         538
//

If you have problems or comments...

PBIL Back to PBIL home page