(data stored in ACNUC7421 zone)

EMBL: AP010803.PE74

AP010803.PE74        Location/Qualifiers
FT   CDS             78078..78374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00740"
FT                   /product="Sel1-like TPR repeat protein"
FT                   /note="FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94908"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX26"
FT                   /protein_id="BAI94908.1"
FT                   /translation="MANGLKSAQFLMESRYAGAAGGTAEACFDLGVAYSCGTGGLPVDL
FT                   IEAHKWFNLAALKGSEEGQTMRAEVAGEMSAREIAEAQRQARALMAATQLRAA"
     MANGLKSAQF LMESRYAGAA GGTAEACFDL GVAYSCGTGG LPVDLIEAHK WFNLAALKGS        60
     EEGQTMRAEV AGEMSAREIA EAQRQARALM AATQLRAA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page