(data stored in ACNUC7421 zone)

EMBL: AP010803.PE77

AP010803.PE77        Location/Qualifiers
FT   CDS             complement(79472..80605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00770"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94911"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX29"
FT                   /protein_id="BAI94911.1"
FT                   /translation="MARLAQGVAELPRDQWDACAGDANPFMSWDFLTALERSGSVGGHS
FT                   GWQPLPLVIDGPDGRIAAAAPLYGKTHSQGEYVFDHGWADAWERAGGQYYPKIQIASPF
FT                   SPVPGPRLLLRDEALAPALVAGIEAVVEQNGLSSAHATFVAPEQVPLFEAAGWLIREDS
FT                   QFHWTNRGYRDFSDFLADLSSAKRKNIRKERERAVEGLEIVHLTGPALTEAHWDIFWTF
FT                   YQDTGARKWGRPYLTRAFFSLLGESMADRVLLVLALRQGQPIAGALNLIGADTLYGRYW
FT                   GCTEDVPNLHFELCYYQAIDIAIARGLKRVEAGAQGGHKLARGYAPEPTFSAHFIPNDS
FT                   FRRAVADFLAAERQGVQRDRIWLTERTPFRKGEARPD"
     MARLAQGVAE LPRDQWDACA GDANPFMSWD FLTALERSGS VGGHSGWQPL PLVIDGPDGR        60
     IAAAAPLYGK THSQGEYVFD HGWADAWERA GGQYYPKIQI ASPFSPVPGP RLLLRDEALA       120
     PALVAGIEAV VEQNGLSSAH ATFVAPEQVP LFEAAGWLIR EDSQFHWTNR GYRDFSDFLA       180
     DLSSAKRKNI RKERERAVEG LEIVHLTGPA LTEAHWDIFW TFYQDTGARK WGRPYLTRAF       240
     FSLLGESMAD RVLLVLALRQ GQPIAGALNL IGADTLYGRY WGCTEDVPNL HFELCYYQAI       300
     DIAIARGLKR VEAGAQGGHK LARGYAPEPT FSAHFIPNDS FRRAVADFLA AERQGVQRDR       360
     IWLTERTPFR KGEARPD                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page