(data stored in ACNUC7421 zone)

EMBL: AP010803.PE8

AP010803.PE8         Location/Qualifiers
FT   CDS             4968..5477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00080"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94842"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW0"
FT                   /protein_id="BAI94842.1"
FT                   /translation="MPCSPVARRVTQPDRESAASALPSGEEAHFRALESLYRSAPINRL
FT                   FRSQLTIPEEGRSIIHFDVDETQFHAAGAVHGTVYFKMLDDAAFYAANSLVSDRFLLTT
FT                   SFNLLFTRPIGPGRIRAEGRWISGRRRVYVAEASLIDADGEEVGRGTGTFMRSQFPLSS
FT                   LPGYAD"
     MPCSPVARRV TQPDRESAAS ALPSGEEAHF RALESLYRSA PINRLFRSQL TIPEEGRSII        60
     HFDVDETQFH AAGAVHGTVY FKMLDDAAFY AANSLVSDRF LLTTSFNLLF TRPIGPGRIR       120
     AEGRWISGRR RVYVAEASLI DADGEEVGRG TGTFMRSQFP LSSLPGYAD                   169
//

If you have problems or comments...

PBIL Back to PBIL home page