(data stored in ACNUC7421 zone)

EMBL: AP010803.PE80

AP010803.PE80        Location/Qualifiers
FT   CDS             complement(81777..82448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94914"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX32"
FT                   /protein_id="BAI94914.1"
FT                   /translation="MNRPLIITDCDEVLLHMVVPFREWLDESHDIHFDMHDRGFGEALR
FT                   HKDSGQPVERALVWELLLGFFETQMHRQTPIAGAVEAMGRLGRIADIVVLTNITERHHL
FT                   QRIEQLAAHGLDLPVHWNQGGKGEPLAAILAERQPGVALFIDDLAQHHASVADHAPGVW
FT                   RLHMVGEPQIAASVPVAPLAHARIDDWAAAEAWIAARLAEGPAPETPAPQGSPTIQGAS
FT                   A"
     MNRPLIITDC DEVLLHMVVP FREWLDESHD IHFDMHDRGF GEALRHKDSG QPVERALVWE        60
     LLLGFFETQM HRQTPIAGAV EAMGRLGRIA DIVVLTNITE RHHLQRIEQL AAHGLDLPVH       120
     WNQGGKGEPL AAILAERQPG VALFIDDLAQ HHASVADHAP GVWRLHMVGE PQIAASVPVA       180
     PLAHARIDDW AAAEAWIAAR LAEGPAPETP APQGSPTIQG ASA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page