(data stored in ACNUC7421 zone)

EMBL: AP010803.PE81

AP010803.PE81        Location/Qualifiers
FT   CDS             complement(82445..82741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94915"
FT                   /db_xref="InterPro:IPR021955"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX33"
FT                   /protein_id="BAI94915.1"
FT                   /translation="MRPDINHGKQHSRSETREPSVLALMALAWTLADDRRADRLLALTG
FT                   LDADALRAGVADPAILGAVLGFLADHEPDLIACAESIDSSPEALITAKERLAA"
     MRPDINHGKQ HSRSETREPS VLALMALAWT LADDRRADRL LALTGLDADA LRAGVADPAI        60
     LGAVLGFLAD HEPDLIACAE SIDSSPEALI TAKERLAA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page