(data stored in ACNUC7421 zone)

EMBL: AP010803.PE87

AP010803.PE87        Location/Qualifiers
FT   CDS             87432..87974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00870"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94921"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX39"
FT                   /protein_id="BAI94921.1"
FT                   /translation="MTERPPQPKSKSRRAKAEERPRIGAPRRIADLMPAIGAAAFRKFG
FT                   FVQSSIVTRWAEIVGPHYAAISEPESIRFPVGKKAGGTLQLTVMSGHAPMIQHVLPDIV
FT                   ERVNRFFGYAAVARVVMKQGMVQAREPERRPPPGNLKPIPVELGDSLRDIGDPELRAVL
FT                   ESLAQGLANSGGLPKIG"
     MTERPPQPKS KSRRAKAEER PRIGAPRRIA DLMPAIGAAA FRKFGFVQSS IVTRWAEIVG        60
     PHYAAISEPE SIRFPVGKKA GGTLQLTVMS GHAPMIQHVL PDIVERVNRF FGYAAVARVV       120
     MKQGMVQARE PERRPPPGNL KPIPVELGDS LRDIGDPELR AVLESLAQGL ANSGGLPKIG       180
//

If you have problems or comments...

PBIL Back to PBIL home page