(data stored in ACNUC7421 zone)

EMBL: AP010803.PE88

AP010803.PE88        Location/Qualifiers
FT   CDS             88004..88318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX40"
FT                   /protein_id="BAI94922.1"
FT                   /translation="MGDWGVWRTSPFLPIERWGGGPPLKAVVEGNGARPPNFLSTSAAP
FT                   TSKRVTCLSSTLLTLRVGRNGDGPWPCSCLRGSMLRWGQGSIHHSHPCRDRGGASLDIA
FT                   "
     MGDWGVWRTS PFLPIERWGG GPPLKAVVEG NGARPPNFLS TSAAPTSKRV TCLSSTLLTL        60
     RVGRNGDGPW PCSCLRGSML RWGQGSIHHS HPCRDRGGAS LDIA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page