(data stored in SCRATCH zone)

EMBL: AP010803.PE89

AP010803.PE89        Location/Qualifiers
FT   CDS             88315..88974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00890"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94923"
FT                   /db_xref="GOA:D4YX41"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX41"
FT                   /protein_id="BAI94923.1"
FT                   /translation="MTKLRLALLPLLAVPASLAAAPAANWLARIALSPIGGHVLGNPGA
FT                   PTKLVEYVSYTCSHCAHFVKEASEPLRAGYVKGGKVSVEVRNAVRDKYDLAAALLARCG
FT                   GPGRFFGNHEALFANQDAWMEKLIAYDKDATKPTEEKAALRDIGQKTGLYALMGKRGFK
FT                   PAQLDACIDDPASMKQILAMTDEAWNKLRIGGTPAFTLNGALVHGSDWTRLQAALP"
     MTKLRLALLP LLAVPASLAA APAANWLARI ALSPIGGHVL GNPGAPTKLV EYVSYTCSHC        60
     AHFVKEASEP LRAGYVKGGK VSVEVRNAVR DKYDLAAALL ARCGGPGRFF GNHEALFANQ       120
     DAWMEKLIAY DKDATKPTEE KAALRDIGQK TGLYALMGKR GFKPAQLDAC IDDPASMKQI       180
     LAMTDEAWNK LRIGGTPAFT LNGALVHGSD WTRLQAALP                              219
//

If you have problems or comments...

PBIL Back to PBIL home page