(data stored in ACNUC7421 zone)

EMBL: AP010803.PE9

AP010803.PE9         Location/Qualifiers
FT   CDS             5506..5817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00090"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94843"
FT                   /db_xref="InterPro:IPR009964"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW1"
FT                   /protein_id="BAI94843.1"
FT                   /translation="MLVGALTRRCAAAGGFATVLVKGDEISGSILLQTLEKGREQGLFE
FT                   RVPDYAGGYRLVRCGPDTEKGQEAMAQYLARRRGSDPDLWVIELDIADAERFAAETIC"
     MLVGALTRRC AAAGGFATVL VKGDEISGSI LLQTLEKGRE QGLFERVPDY AGGYRLVRCG        60
     PDTEKGQEAM AQYLARRRGS DPDLWVIELD IADAERFAAE TIC                         103
//

If you have problems or comments...

PBIL Back to PBIL home page