(data stored in ACNUC7421 zone)

EMBL: AP010803.PE90

AP010803.PE90        Location/Qualifiers
FT   CDS             89030..89764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00900"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94924"
FT                   /db_xref="GOA:D4YX42"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX42"
FT                   /protein_id="BAI94924.1"
FT                   /translation="MKALSGLALIALSLTVAACGKKEEGGATSAQPVAAVAAPAGTTWS
FT                   ETIAATPEGYFLMGNPDAKVKLVEYGSYTCSHCRDFAAESAEEIRQIVDSGKMSFEFRN
FT                   YVRDPIDISTALLARCGGKDIFYPLSDQFFANQNAMFEKAQALGDERYKALMSAPPAQR
FT                   FGQLAEAIGLVDFAKQRGIAEDQAKQCLADTAAAEKLAKTVEDANRQYKIEGTPTFILN
FT                   GVMVENTAAWPALRAKLKEAGI"
     MKALSGLALI ALSLTVAACG KKEEGGATSA QPVAAVAAPA GTTWSETIAA TPEGYFLMGN        60
     PDAKVKLVEY GSYTCSHCRD FAAESAEEIR QIVDSGKMSF EFRNYVRDPI DISTALLARC       120
     GGKDIFYPLS DQFFANQNAM FEKAQALGDE RYKALMSAPP AQRFGQLAEA IGLVDFAKQR       180
     GIAEDQAKQC LADTAAAEKL AKTVEDANRQ YKIEGTPTFI LNGVMVENTA AWPALRAKLK       240
     EAGI                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page