(data stored in SCRATCH zone)

EMBL: AP010803.PE96

AP010803.PE96        Location/Qualifiers
FT   CDS             complement(98147..99442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00960"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94930"
FT                   /db_xref="GOA:D4YX48"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX48"
FT                   /protein_id="BAI94930.1"
FT                   /translation="MTNPADPCPKSAVSHGVGMAGLVGLGLWTLVARHYGMNGPNAGFA
FT                   AVAACGLPMVLWSLLVDKVHRRASTGIDWTAPARPWRAVLDVSIVKIAGLWATWLAIAV
FT                   FYCIARWYWSGDYRLSMNVLMGAAPWLLAASVPYVIWLDRRLIEPRDASHAFGQWVIGG
FT                   AAGAPDKAEVAHHARAWAVKGFFLAFMLSIVPGNFASVVDLRIEEAFGHPVALASFLIA
FT                   VMFMIDVCMATVGYMLTMKPLDSHIRTANPLLAGWVAALICYPPFVLMGNGGPIDYHAG
FT                   GAEWDVWTRGHEALQWLLGGWLVLLTAIYAWATVAFGLRFSNLTHRGILTHGPYRWTRH
FT                   PAYLSKNLFWWFSALPFLSLSGSLTDVVRNCALLGVTNAVYYWRAKTEEAHLGADPEYR
FT                   AYSDWMERNGAVPRFFAWIAGRKAVGLAQPAE"
     MTNPADPCPK SAVSHGVGMA GLVGLGLWTL VARHYGMNGP NAGFAAVAAC GLPMVLWSLL        60
     VDKVHRRAST GIDWTAPARP WRAVLDVSIV KIAGLWATWL AIAVFYCIAR WYWSGDYRLS       120
     MNVLMGAAPW LLAASVPYVI WLDRRLIEPR DASHAFGQWV IGGAAGAPDK AEVAHHARAW       180
     AVKGFFLAFM LSIVPGNFAS VVDLRIEEAF GHPVALASFL IAVMFMIDVC MATVGYMLTM       240
     KPLDSHIRTA NPLLAGWVAA LICYPPFVLM GNGGPIDYHA GGAEWDVWTR GHEALQWLLG       300
     GWLVLLTAIY AWATVAFGLR FSNLTHRGIL THGPYRWTRH PAYLSKNLFW WFSALPFLSL       360
     SGSLTDVVRN CALLGVTNAV YYWRAKTEEA HLGADPEYRA YSDWMERNGA VPRFFAWIAG       420
     RKAVGLAQPA E                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page