(data stored in SCRATCH zone)

EMBL: AP010803.PE97

AP010803.PE97        Location/Qualifiers
FT   CDS             complement(99653..100279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00970"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94931"
FT                   /db_xref="GOA:D4YX49"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX49"
FT                   /protein_id="BAI94931.1"
FT                   /translation="MSRSRIFPWRYGMFLALLASMAPLGLLLPWHEAVMAGFDLAALAF
FT                   ILSAWPLLDSDADAMRRKAAENDANRRLMLLLTAIVSVVILVAVGVAVSQHGGPSRAAI
FT                   ALLLATLALAWLFSNLVYAMHYAHIFYLDDGKGGDSGGLDFPGMREPDYWDFLYFAFTL
FT                   GMTFQTSDVSVTSRSMRQAALFHCLAAFLFNLGILAFTINVLGGG"
     MSRSRIFPWR YGMFLALLAS MAPLGLLLPW HEAVMAGFDL AALAFILSAW PLLDSDADAM        60
     RRKAAENDAN RRLMLLLTAI VSVVILVAVG VAVSQHGGPS RAAIALLLAT LALAWLFSNL       120
     VYAMHYAHIF YLDDGKGGDS GGLDFPGMRE PDYWDFLYFA FTLGMTFQTS DVSVTSRSMR       180
     QAALFHCLAA FLFNLGILAF TINVLGGG                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page