(data stored in ACNUC7421 zone)

EMBL: AP010803.PE98

AP010803.PE98        Location/Qualifiers
FT   CDS             complement(100321..100896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00980"
FT                   /product="hypothetical protein"
FT                   /note="protease subunit of ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94932"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX50"
FT                   /protein_id="BAI94932.1"
FT                   /translation="MSMQAPLLGPRDFEYPAIMLSGYVDHGMYLHFRNCLSSAPQQGLV
FT                   VVEIATLGGDPEIARMMGEDIRFHSDLYPDRRLVFLGKTAVYSAGATFMSFFAAENRYL
FT                   ARGTRLMIHERIITRDIHLEGPLSTCIASLKATLHEIEASISIQNEGFANLILGSQVSM
FT                   EELLNRAPENWYLEASEAQALGLIAAVI"
     MSMQAPLLGP RDFEYPAIML SGYVDHGMYL HFRNCLSSAP QQGLVVVEIA TLGGDPEIAR        60
     MMGEDIRFHS DLYPDRRLVF LGKTAVYSAG ATFMSFFAAE NRYLARGTRL MIHERIITRD       120
     IHLEGPLSTC IASLKATLHE IEASISIQNE GFANLILGSQ VSMEELLNRA PENWYLEASE       180
     AQALGLIAAV I                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page