(data stored in SCRATCH zone)

EMBL: AP010803.PFKB

AP010803.PFKB        Location/Qualifiers
FT   CDS             327718..328719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="SJA_C1-03120"
FT                   /product="ribokinase family sugar kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95146"
FT                   /db_xref="GOA:D4YXR4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR4"
FT                   /protein_id="BAI95146.1"
FT                   /translation="MTAAAPTLDVVAIGNAIVDVLARSDDAFLAEHALTKGGMQLIDAE
FT                   TAESLYADMGAGKEISGGSAANTLAGLAALGKKCGFIGQVNDDQLGAVFAHDVRALGIR
FT                   YDTPAMRGDVPTARCLILVTPDAQRTMNTFLGASQFLPEAALDLDLIRSASILYLEGYL
FT                   WDPEQPRAAMRAAIDAARGAGRKVAFTLSDNFVIDRHRSDFLDLIDQGLIDILFSNEGE
FT                   IQSLAGVHDFDAAVAAIAPKVPVLVSTRSEKGAIAVVEGLRYEAHAAPVAEVIDTTGAG
FT                   DLFAAGFLAGHLEGLEVDKCLKLGAAAAAEVISHWGARPEEDLKAIRAKTLG"
     MTAAAPTLDV VAIGNAIVDV LARSDDAFLA EHALTKGGMQ LIDAETAESL YADMGAGKEI        60
     SGGSAANTLA GLAALGKKCG FIGQVNDDQL GAVFAHDVRA LGIRYDTPAM RGDVPTARCL       120
     ILVTPDAQRT MNTFLGASQF LPEAALDLDL IRSASILYLE GYLWDPEQPR AAMRAAIDAA       180
     RGAGRKVAFT LSDNFVIDRH RSDFLDLIDQ GLIDILFSNE GEIQSLAGVH DFDAAVAAIA       240
     PKVPVLVSTR SEKGAIAVVE GLRYEAHAAP VAEVIDTTGA GDLFAAGFLA GHLEGLEVDK       300
     CLKLGAAAAA EVISHWGARP EEDLKAIRAK TLG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page