(data stored in ACNUC7421 zone)

EMBL: AP010803.PHZ

AP010803.PHZ         Location/Qualifiers
FT   CDS             complement(178151..178945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phz"
FT                   /locus_tag="SJA_C1-01700"
FT                   /product="phenazine biosynthesis protein"
FT                   /note="putative epimerase, PhzC/PhzF homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95004"
FT                   /db_xref="GOA:D4YXC2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC2"
FT                   /protein_id="BAI95004.1"
FT                   /translation="MPVTSLPIIQVDAFADAPFTGNPAAVMPLGQWLDDATLQAIAAEN
FT                   NLSETAFTVPTPDDPEADYALRWFTPAVEVKLCGHATLASGHVLMGGRTAVRFRTRQAG
FT                   ILSVSRDRDGYALSLPAWPTGPTPLPELAEAMGGDILETQWREGGYAIFLYRDAAAIRA
FT                   LEPDFATLKKAGPILLIATAPGDDSDIVSRVFVPGAGIDEDPVTGSAHCLLTPYWAKRL
FT                   DKAALTAFQASRRGGRLSCRLSGDRVILTGACRTVIEGNFLL"
     MPVTSLPIIQ VDAFADAPFT GNPAAVMPLG QWLDDATLQA IAAENNLSET AFTVPTPDDP        60
     EADYALRWFT PAVEVKLCGH ATLASGHVLM GGRTAVRFRT RQAGILSVSR DRDGYALSLP       120
     AWPTGPTPLP ELAEAMGGDI LETQWREGGY AIFLYRDAAA IRALEPDFAT LKKAGPILLI       180
     ATAPGDDSDI VSRVFVPGAG IDEDPVTGSA HCLLTPYWAK RLDKAALTAF QASRRGGRLS       240
     CRLSGDRVIL TGACRTVIEG NFLL                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page