(data stored in ACNUC7421 zone)

EMBL: AP010803.PLD

AP010803.PLD         Location/Qualifiers
FT   CDS             complement(93325..94782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plD"
FT                   /locus_tag="SJA_C1-00920"
FT                   /product="phospholipase D"
FT                   /EC_number="3.1.4.4"
FT                   /note="phospholipase D /
FT                   phosphatidylserine/phosphatidylglycerophosphate/
FT                   cardiolipin synthase or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94926"
FT                   /db_xref="GOA:D4YX44"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX44"
FT                   /protein_id="BAI94926.1"
FT                   /translation="MSGPREGEDCWRIARALKASVIVDADAYFRHARAAMMKAKRRIML
FT                   IGWDFDAAITLIREDEASDGAPTVIGDFISWLVERTPELEIFLLRWDVGAMKSMARPSN
FT                   LFTTVRWMVNPRITVKLDSHHPTAASHHQKIVVIDDCFAFCGGIDMTGDRWDTRHHRDG
FT                   EPWRRHPDGSPYGPWHDATTALQGPVAAALGQHARARWKGAGGGELPPVEGQQDCWPDA
FT                   LPVQFEDVDIAISRSAPEMEDQEPLIEIERLYVNQIAAARRHIYAESQYFASRRIAEAI
FT                   AARLAEEDGPEIVIVNPEQADGWLEQQAMDTARARLFEALKARDAHGRFRLYHPFTARG
FT                   EPIYVHAKILIVDDRVLRVGSSNMNNRSMRLDTECDVTIDAALPANAGREDAIRAIRDD
FT                   LIAEHLDLPVERVAAVIAEQGLIAAIEQLRDRPGRTLRPYVTPDLNGVQAWLADNEALD
FT                   PEGPGEMLEPITERGLFRRMRGWMEGD"
     MSGPREGEDC WRIARALKAS VIVDADAYFR HARAAMMKAK RRIMLIGWDF DAAITLIRED        60
     EASDGAPTVI GDFISWLVER TPELEIFLLR WDVGAMKSMA RPSNLFTTVR WMVNPRITVK       120
     LDSHHPTAAS HHQKIVVIDD CFAFCGGIDM TGDRWDTRHH RDGEPWRRHP DGSPYGPWHD       180
     ATTALQGPVA AALGQHARAR WKGAGGGELP PVEGQQDCWP DALPVQFEDV DIAISRSAPE       240
     MEDQEPLIEI ERLYVNQIAA ARRHIYAESQ YFASRRIAEA IAARLAEEDG PEIVIVNPEQ       300
     ADGWLEQQAM DTARARLFEA LKARDAHGRF RLYHPFTARG EPIYVHAKIL IVDDRVLRVG       360
     SSNMNNRSMR LDTECDVTID AALPANAGRE DAIRAIRDDL IAEHLDLPVE RVAAVIAEQG       420
     LIAAIEQLRD RPGRTLRPYV TPDLNGVQAW LADNEALDPE GPGEMLEPIT ERGLFRRMRG       480
     WMEGD                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page