(data stored in SCRATCH zone)

EMBL: AP010803.PTSN

AP010803.PTSN        Location/Qualifiers
FT   CDS             4466..5008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="SJA_C1-00070"
FT                   /product="PTS system nitrogen regulatory IIA component"
FT                   /note="phosphotransferase system mannitol/fructose-specific
FT                   IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94841"
FT                   /db_xref="GOA:D4YWV9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV9"
FT                   /protein_id="BAI94841.1"
FT                   /translation="MGPDFKDPGIASIFPKLGAARLGFGMVHFNDIVAPDALGTALSVN
FT                   GKKQLFQKVATLAAQAYGLEADMVAEALLEREKLGSTGFGGGVAIPHAKIPGLQKMCGV
FT                   VVLLDPVVPFDAVDEAPVDIVFALLSPIDSGAEHLKTLARVSRYLRDEGQVARLRGAKS
FT                   TAALHALLAGGEARDAA"
     MGPDFKDPGI ASIFPKLGAA RLGFGMVHFN DIVAPDALGT ALSVNGKKQL FQKVATLAAQ        60
     AYGLEADMVA EALLEREKLG STGFGGGVAI PHAKIPGLQK MCGVVVLLDP VVPFDAVDEA       120
     PVDIVFALLS PIDSGAEHLK TLARVSRYLR DEGQVARLRG AKSTAALHAL LAGGEARDAA       180
//

If you have problems or comments...

PBIL Back to PBIL home page